PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen04g034380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 645aa    MW: 71982.2 Da    PI: 5.8994
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen04g034380.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.92e-094044411954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yp+ +e+  LA+++gLt +qV +WF N R +
  Sopen04g034380.1 404 FEHflHPYPKDSEKIMLARQTGLTRSQVANWFINARVR 441
                       554459******************************88 PP

2BELL1231.2e-39270341172
              BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       er++l++k +kL s+l+eVd+rYk y++q+q+v+ssFe+vaglg+akpYtslAlk+iSr+FrcL+dai++qi
  Sopen04g034380.1 270 ERHDLESKMTKLFSMLDEVDRRYKEYYQQMQVVVSSFEMVAGLGAAKPYTSLALKTISRQFRCLRDAIKKQI 341
                       799********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.3E-54194339IPR006563POX domain
PfamPF075262.7E-47200337IPR006563POX domain
PROSITE profilePS5007112.341382445IPR001356Homeobox domain
CDDcd000866.87E-13385446No hitNo description
SMARTSM003894.4E-10385449IPR001356Homeobox domain
SuperFamilySSF466892.4E-17386452IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-28388451IPR009057Homeodomain-like
PfamPF059202.1E-17402441IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 645 aa     Download sequence    Send to blast
MSFLPDQKFA SYQSTGLSDS PVHLNQHSAS VSYSELPSQN YGEVQTMKGK DEMLFIPPTS  60
ESGGMQPIGR AVNAVPNFLE NSVMMDPHSF PIKQLLVPNG EQSLQNQGLS LSLGTQVPPS  120
LHVYSYQDDY TNSSLSSLVG THVLHSEQGS ENKESKVAEY LSFDLAGGSR AANNPQSSMT  180
LRELNSGVHS HVGSGAAAAI YNSKYLKAAQ DLLDEVVNVQ EALKQSDKLR NFNLLSHDRS  240
EEADFKSSSS ATGISDDHNT LTKGELSATE RHDLESKMTK LFSMLDEVDR RYKEYYQQMQ  300
VVVSSFEMVA GLGAAKPYTS LALKTISRQF RCLRDAIKKQ IQVTRRSLGE QGDSQGERLY  360
RLRYVDQQLR QQRSLQQFGM MRQPWRPQRG LPETAVSVLR AWLFEHFLHP YPKDSEKIML  420
ARQTGLTRSQ VANWFINARV RLWKPMIEDM YKEEFGVAEA GSGASPERVP VDSKEKSIAE  480
NTGEDIPESF TIPAANCSHL DPSDESSNIV TNVHNNSFTT KFSFQDGDYE HDRIDCGSNK  540
LQSEQIPIAH GFGPKPTSDG SIIGPVNTYH PSMLGDIMGN QVSLALRLQN SQMDQQPISG  600
RPQLRQDEKT DSTHVDISKG EYYYIDPVNQ QERFSGSHLL SDFVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A7e-17391448158Homeobox protein Meis1
4xrs_B7e-17391448158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015074094.10.0PREDICTED: BEL1-like homeodomain protein 3
RefseqXP_015074095.10.0PREDICTED: BEL1-like homeodomain protein 3
RefseqXP_015074096.10.0PREDICTED: BEL1-like homeodomain protein 3
SwissprotQ9FWS91e-112BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLK4BVF80.0K4BVF8_SOLLC; Uncharacterized protein
STRINGSolyc04g080790.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA112582022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.21e-101BEL1-like homeodomain 3